Lineage for d1okvd1 (1okv D:173-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718351Domain d1okvd1: 1okv D:173-309 [93286]
    Other proteins in same PDB: d1okva_, d1okvc_

Details for d1okvd1

PDB Entry: 1okv (more details), 2.4 Å

PDB Description: cyclin a binding groove inhibitor h-arg-arg-leu-ile-phe-nh2
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d1okvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okvd1 a.74.1.1 (D:173-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
nevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
rmehlvlkvltfdlaap

SCOPe Domain Coordinates for d1okvd1:

Click to download the PDB-style file with coordinates for d1okvd1.
(The format of our PDB-style files is described here.)

Timeline for d1okvd1: