SCOP 1.67: Domain d1okta1: 1okt A:86-211

Lineage for d1okta1 (1okt A:86-211)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Pf GST [101210] (1 species)
   cannot be assigned to any of the known GST classes

7. Species Malarial parasite (Plasmodium falciparum) [TaxId:5833] [101211] (3 PDB entries)

8. Domain d1okta1: 1okt A:86-211 [93272]
   Other proteins in same PDB: d1okta2, d1oktb2

Details for d1okta1

PDB Entry: 1okt, 1.9 Å

PDB Description: x-ray structure of glutathione s-transferase from the malarial parasite plasmodium falciparum

SCOP Domain Sequences for d1okta1:

Sequence; same for both SEQRES and ATOM records:

>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum)}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy

Timeline for d1okta1:

• d1okta1 is new in SCOP 1.67
  
• d1okta1 appears in SCOP 1.69
  
• d1okta1 appears in the current release, SCOPe 2.08