Lineage for d1ok6e_ (1ok6 E:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385592Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 385593Family c.1.10.1: Class I aldolase [51570] (10 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 385594Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species)
  7. 385595Species Archaeon Thermoproteus tenax [TaxId:2271] [102089] (3 PDB entries)
  8. 385620Domain d1ok6e_: 1ok6 E: [93230]

Details for d1ok6e_

PDB Entry: 1ok6 (more details), 2.4 Å

PDB Description: orthorhombic crystal form of an archaeal fructose 1,6-bisphosphate aldolase

SCOP Domain Sequences for d1ok6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ok6e_ c.1.10.1 (E:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax}
anltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfq
rgiaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfew
kmfeelarikrdavkfdlplvvwsyprggkvvnetapeivayaarialelgadamkikyt
gdpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdal
kfaralaelvyg

SCOP Domain Coordinates for d1ok6e_:

Click to download the PDB-style file with coordinates for d1ok6e_.
(The format of our PDB-style files is described here.)

Timeline for d1ok6e_: