SCOP 1.71: Domain d1ojvb2: 1ojv B:65-128

Lineage for d1ojvb2 (1ojv B:65-128)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (11 proteins)
   Pfam 00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (14 PDB entries)

8. Domain d1ojvb2: 1ojv B:65-128 [93153]

Details for d1ojvb2

PDB Entry: 1ojv, 2.3 Å

PDB Description: decay accelerating factor (cd55): the structure of an intact human complement regulator.

SCOP Domain Sequences for d1ojvb2:

Sequence; same for both SEQRES and ATOM records:

>d1ojvb2 g.18.1.1 (B:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens)}
scevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwstave
fckk

Timeline for d1ojvb2:

• d1ojvb2 first appeared in SCOP 1.67
  
• d1ojvb2 appears in SCOP 1.69
  
• d1ojvb2 appears in SCOP 1.73
  
• d1ojvb2 appears in the current release, SCOPe 2.08