SCOPe 2.08: Domain d1ojkb_: 1ojk B:

Lineage for d1ojkb_ (1ojk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)

7. Species Humicola insolens, Cel7b [TaxId:34413] [49977] (6 PDB entries)

8. Domain d1ojkb_: 1ojk B: [93133]
   complexed with gol, nag; mutant

Details for d1ojkb_

PDB Entry: 1ojk, 1.5 Å

PDB Description: anatomy of glycosynthesis: structure and kinetics of the humicola insolens cel7be197a and e197s glycosynthase mutants

PDB Compounds: (B:) endoglucanase I

SCOPe Domain Sequences for d1ojkb_:

Sequence; same for both SEQRES and ATOM records:

>d1ojkb_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Humicola insolens, Cel7b [TaxId: 34413]}
ekpgetkevhpqlttfrctkrggckpatnfivldslshpihraeglgpggcgdwgnpppk
dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
finglgniegkgsccnsmdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
eagpcakgegapsnivqvepfpevtytnlrwgeigstyq

Timeline for d1ojkb_:

• d1ojkb_ first appeared in SCOP 1.67
  
• d1ojkb_ appears in SCOPe 2.07