Lineage for d1ojcb1 (1ojc B:3-289,B:402-496)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822334Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 822426Protein Monoamine oxidase B [69423] (2 species)
  7. 822427Species Human (Homo sapiens) [TaxId:9606] [69424] (15 PDB entries)
  8. 822453Domain d1ojcb1: 1ojc B:3-289,B:402-496 [93106]
    Other proteins in same PDB: d1ojca2, d1ojcb2
    complexed with fad, laz

Details for d1ojcb1

PDB Entry: 1ojc (more details), 2.4 Å

PDB Description: human monoamine oxidase b in complex with n-(2-aminoethyl)-p-chlorobenzamide
PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOP Domain Sequences for d1ojcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojcb1 c.3.1.2 (B:3-289,B:402-496) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrli

SCOP Domain Coordinates for d1ojcb1:

Click to download the PDB-style file with coordinates for d1ojcb1.
(The format of our PDB-style files is described here.)

Timeline for d1ojcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojcb2