Lineage for d1ojba1 (1ojb A:3-289,A:402-501)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 576286Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 576287Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 576341Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (14 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 576399Protein Monoamine oxidase B [69423] (2 species)
  7. 576400Species Human (Homo sapiens) [TaxId:9606] [69424] (10 PDB entries)
  8. 576411Domain d1ojba1: 1ojb A:3-289,A:402-501 [93100]
    Other proteins in same PDB: d1ojba2, d1ojbb2

Details for d1ojba1

PDB Entry: 1ojb (more details), 2.2 Å

PDB Description: human monoamine oxidase b in complex with tranylcypromine

SCOP Domain Sequences for d1ojba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojba1 c.3.1.2 (A:3-289,A:402-501) Monoamine oxidase B {Human (Homo sapiens)}
nkcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvg
ptqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtm
ddmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsa
lwflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtr
envlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrv
lrqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvp
aqpitttflerhlpsvpgllrligltti

SCOP Domain Coordinates for d1ojba1:

Click to download the PDB-style file with coordinates for d1ojba1.
(The format of our PDB-style files is described here.)

Timeline for d1ojba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojba2