Lineage for d1ojaa2 (1oja A:290-401)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718307Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 718308Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 718491Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 718515Protein Monoamine oxidase B [69673] (2 species)
  7. 718516Species Human (Homo sapiens) [TaxId:9606] [69674] (10 PDB entries)
  8. 718519Domain d1ojaa2: 1oja A:290-401 [93097]
    Other proteins in same PDB: d1ojaa1, d1ojab1

Details for d1ojaa2

PDB Entry: 1oja (more details), 1.7 Å

PDB Description: human monoamine oxidase b in complex with isatin
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOP Domain Sequences for d1ojaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojaa2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d1ojaa2:

Click to download the PDB-style file with coordinates for d1ojaa2.
(The format of our PDB-style files is described here.)

Timeline for d1ojaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojaa1