Lineage for d1oj9a2 (1oj9 A:290-401)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 855121Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 855155Protein Monoamine oxidase B [69673] (2 species)
  7. 855156Species Human (Homo sapiens) [TaxId:9606] [69674] (15 PDB entries)
  8. 855179Domain d1oj9a2: 1oj9 A:290-401 [93093]
    Other proteins in same PDB: d1oj9a1, d1oj9b1

Details for d1oj9a2

PDB Entry: 1oj9 (more details), 2.3 Å

PDB Description: human monoamine oxidase b in complex with 1,4-diphenyl-2-butene
PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOP Domain Sequences for d1oj9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj9a2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d1oj9a2:

Click to download the PDB-style file with coordinates for d1oj9a2.
(The format of our PDB-style files is described here.)

Timeline for d1oj9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oj9a1