| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
| Family a.1.1.2: Globins [46463] (20 proteins) Heme-binding protein |
| Protein Neuroglobin [100978] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [100979] (1 PDB entry) |
| Domain d1oj6d_: 1oj6 D: [93091] complexed with hem, so4; mutant |
PDB Entry: 1oj6 (more details), 1.95 Å
SCOP Domain Sequences for d1oj6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oj6d_ a.1.1.2 (D:) Neuroglobin {Human (Homo sapiens)}
merpepelirqswravsrsplehgtvlfarlfalepdllplfqyngrqfsspedslsspe
fldhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymleks
lgpaftpatraawsqlygavvqamsrgwdg
Timeline for d1oj6d_: