SCOP 1.75: Domain d1oj6a_: 1oj6 A:

Lineage for d1oj6a_ (1oj6 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [100979] (1 PDB entry)

8. Domain d1oj6a_: 1oj6 A: [93088]

Details for d1oj6a_

PDB Entry: 1oj6, 1.95 Å

PDB Description: human brain neuroglobin three-dimensional structure

PDB Compounds: (A:) neuroglobin

SCOP Domain Sequences for d1oj6a_:

Sequence; same for both SEQRES and ATOM records:

>d1oj6a_ a.1.1.2 (A:) Neuroglobin {Human (Homo sapiens) [TaxId: 9606]}
rpepelirqswravsrsplehgtvlfarlfalepdllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekslg
paftpatraawsqlygavvqamsrgwd

Timeline for d1oj6a_:

• d1oj6a_ first appeared in SCOP 1.67
  
• d1oj6a_ appears in SCOP 1.73
  
• d1oj6a_ appears in SCOPe 2.01
  
• d1oj6a_ appears in the current release, SCOPe 2.08