SCOPe 2.05: Domain d1oiwa_: 1oiw A:

Lineage for d1oiwa_ (1oiw A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab11a [102362] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102363] (4 PDB entries)

8. Domain d1oiwa_: 1oiw A: [93078]
   complexed with gsp, mg

Details for d1oiwa_

PDB Entry: 1oiw, 2.05 Å

PDB Description: x-ray structure of the small g protein rab11a in complex with gtpgammas

PDB Compounds: (A:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d1oiwa_:

Sequence; same for both SEQRES and ATOM records:

>d1oiwa_ c.37.1.8 (A:) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

Timeline for d1oiwa_:

• d1oiwa_ first appeared in SCOP 1.67
  
• d1oiwa_ appears in SCOPe 2.04
  
• d1oiwa_ appears in SCOPe 2.06
  
• d1oiwa_ appears in the current release, SCOPe 2.08