Lineage for d1oivb_ (1oiv B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846475Protein Rab11a [102362] (2 species)
  7. 1846482Species Human (Homo sapiens) [TaxId:9606] [102363] (4 PDB entries)
  8. 1846487Domain d1oivb_: 1oiv B: [93077]
    complexed with edo, gdp, so4

Details for d1oivb_

PDB Entry: 1oiv (more details), 1.98 Å

PDB Description: x-ray structure of the small g protein rab11a in complex with gdp
PDB Compounds: (B:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d1oivb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oivb_ c.37.1.8 (B:) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

SCOPe Domain Coordinates for d1oivb_:

Click to download the PDB-style file with coordinates for d1oivb_.
(The format of our PDB-style files is described here.)

Timeline for d1oivb_: