SCOP 1.67: Domain d1oiva_: 1oiv A:

Lineage for d1oiva_ (1oiv A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab11a [102362] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102363] (2 PDB entries)

8. Domain d1oiva_: 1oiv A: [93076]

Details for d1oiva_

PDB Entry: 1oiv, 1.98 Å

PDB Description: x-ray structure of the small g protein rab11a in complex with gdp

SCOP Domain Sequences for d1oiva_:

Sequence; same for both SEQRES and ATOM records:

>d1oiva_ c.37.1.8 (A:) Rab11a {Human (Homo sapiens)}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

Timeline for d1oiva_:

• d1oiva_ is new in SCOP 1.67
  
• d1oiva_ appears in SCOP 1.69
  
• d1oiva_ appears in the current release, SCOPe 2.08