SCOP 1.71: Domain d1oiob_: 1oio B:

Lineage for d1oiob_ (1oio B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.5: F17c-type adhesin [89215] (2 proteins)

6. Protein Fimbrial lectin GafD [101552] (1 species)

7. Species Escherichia coli [TaxId:562] [101553] (1 PDB entry)

8. Domain d1oiob_: 1oio B: [93070]
   complexed with nag

Details for d1oiob_

PDB Entry: 1oio, 1.7 Å

PDB Description: gafd (f17c-type) fimbrial adhesin from escherichia coli

SCOP Domain Sequences for d1oiob_:

Sequence; same for both SEQRES and ATOM records:

>d1oiob_ b.2.3.5 (B:) Fimbrial lectin GafD {Escherichia coli}
avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt

Timeline for d1oiob_:

• d1oiob_ first appeared in SCOP 1.67
  
• d1oiob_ appears in SCOP 1.69
  
• d1oiob_ appears in SCOP 1.73
  
• d1oiob_ appears in the current release, SCOPe 2.08