![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.5: F17c-type adhesin [89215] (3 proteins) |
![]() | Protein Fimbrial lectin GafD [101552] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [101553] (1 PDB entry) |
![]() | Domain d1oioa_: 1oio A: [93069] complexed with nag |
PDB Entry: 1oio (more details), 1.7 Å
SCOPe Domain Sequences for d1oioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oioa_ b.2.3.5 (A:) Fimbrial lectin GafD {Escherichia coli [TaxId: 562]} avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt
Timeline for d1oioa_: