Lineage for d1oioa_ (1oio A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.3: Bacterial adhesins [49401] (6 families) 
Family b.2.3.5: F17c-type adhesin [89215] (2 proteins) 
Protein Fimbrial lectin GafD [101552] (1 species) Species Escherichia coli [TaxId:562] [101553] (1 PDB entry) 
Domain d1oioa_: 1oio A: [93069]
Details for d1oioa_
PDB Entry: 1oio (more details), 1.7 Å
PDB Description: gafd (f17c-type) fimbrial adhesin from escherichia coli
SCOP Domain Sequences for d1oioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oioa_ b.2.3.5 (A:) Fimbrial lectin GafD {Escherichia coli}
avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt
SCOP Domain Coordinates for d1oioa_:
Click to download the PDB-style file with coordinates for d1oioa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oioa_:
- d1oioa_ first appeared in SCOP 1.67
- d1oioa_ appears in SCOP 1.71
- d1oioa_ appears in the current release, SCOPe 2.08
View in 3D
