Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) |
Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins) Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1) |
Protein Hypothetical protein AF2198 [102714] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [102715] (2 PDB entries) |
Domain d1oi0d_: 1oi0 D: [93048] complexed with 144, zn missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1oi0 (more details), 1.5 Å
SCOPe Domain Sequences for d1oi0d_:
Sequence, based on SEQRES records: (download)
>d1oi0d_ c.97.3.1 (D:) Hypothetical protein AF2198 {Archaeoglobus fulgidus [TaxId: 2234]} mkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlpigm kvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelevve
>d1oi0d_ c.97.3.1 (D:) Hypothetical protein AF2198 {Archaeoglobus fulgidus [TaxId: 2234]} mkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgpigmkvfgtvhshps pscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelevve
Timeline for d1oi0d_: