Lineage for d1oi0a_ (1oi0 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404230Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
  4. 404282Superfamily c.97.3: JAB1/MPN domain [102712] (1 family) (S)
  5. 404283Family c.97.3.1: JAB1/MPN domain [102713] (1 protein)
    synonym Mov34, PAD-1; Pfam01398
  6. 404284Protein Hypothetical protein AF2198 [102714] (1 species)
  7. 404285Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [102715] (2 PDB entries)
  8. 404286Domain d1oi0a_: 1oi0 A: [93045]

Details for d1oi0a_

PDB Entry: 1oi0 (more details), 1.5 Å

PDB Description: crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus

SCOP Domain Sequences for d1oi0a_:

Sequence, based on SEQRES records: (download)

>d1oi0a_ c.97.3.1 (A:) Hypothetical protein AF2198 {Archaeon Archaeoglobus fulgidus}
gssmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlp
igmkvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelev
v

Sequence, based on observed residues (ATOM records): (download)

>d1oi0a_ c.97.3.1 (A:) Hypothetical protein AF2198 {Archaeon Archaeoglobus fulgidus}
gssmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsigmkvfgtvhshp
spscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelevv

SCOP Domain Coordinates for d1oi0a_:

Click to download the PDB-style file with coordinates for d1oi0a_.
(The format of our PDB-style files is described here.)

Timeline for d1oi0a_: