Lineage for d1oh8b4 (1oh8 B:14-116)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209287Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1209318Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 1209319Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 1209320Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 1209321Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1209336Domain d1oh8b4: 1oh8 B:14-116 [93010]
    Other proteins in same PDB: d1oh8a1, d1oh8a2, d1oh8a3, d1oh8b1, d1oh8b2, d1oh8b3
    complexed with adp, mg

Details for d1oh8b4

PDB Entry: 1oh8 (more details), 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an unpaired thymidine
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh8b4:

Sequence, based on SEQRES records: (download)

>d1oh8b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagipy
havenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Sequence, based on observed residues (ATOM records): (download)

>d1oh8b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
vnqgesvaicerkvvrivtp

SCOPe Domain Coordinates for d1oh8b4:

Click to download the PDB-style file with coordinates for d1oh8b4.
(The format of our PDB-style files is described here.)

Timeline for d1oh8b4: