Lineage for d1oh8b2 (1oh8 B:567-800)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831595Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 831646Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 831647Species Escherichia coli [TaxId:562] [52699] (10 PDB entries)
    Uniprot P23909 2-800
  8. 831664Domain d1oh8b2: 1oh8 B:567-800 [93008]
    Other proteins in same PDB: d1oh8a1, d1oh8a3, d1oh8a4, d1oh8b1, d1oh8b3, d1oh8b4
    complexed with adp, mo4

Details for d1oh8b2

PDB Entry: 1oh8 (more details), 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an unpaired thymidine
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1oh8b2:

Sequence, based on SEQRES records: (download)

>d1oh8b2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records): (download)

>d1oh8b2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgtfmvemtetanilhnateyslvlmdeig
rgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdti
afmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

SCOP Domain Coordinates for d1oh8b2:

Click to download the PDB-style file with coordinates for d1oh8b2.
(The format of our PDB-style files is described here.)

Timeline for d1oh8b2: