Lineage for d1oh8a1 (1oh8 A:270-566)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359612Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 359613Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 359614Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 359615Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 359616Species Escherichia coli [TaxId:562] [48338] (6 PDB entries)
  8. 359625Domain d1oh8a1: 1oh8 A:270-566 [93003]
    Other proteins in same PDB: d1oh8a2, d1oh8a3, d1oh8a4, d1oh8b2, d1oh8b3, d1oh8b4

Details for d1oh8a1

PDB Entry: 1oh8 (more details), 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an unpaired thymidine

SCOP Domain Sequences for d1oh8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh8a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOP Domain Coordinates for d1oh8a1:

Click to download the PDB-style file with coordinates for d1oh8a1.
(The format of our PDB-style files is described here.)

Timeline for d1oh8a1: