Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) |
Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
Protein DNA repair protein MutS, domain I [55273] (2 species) |
Species Escherichia coli [TaxId:562] [55275] (6 PDB entries) |
Domain d1oh7b4: 1oh7 B:14-116 [93002] Other proteins in same PDB: d1oh7a1, d1oh7a2, d1oh7a3, d1oh7b1, d1oh7b2, d1oh7b3 complexed with adp, mo4 |
PDB Entry: 1oh7 (more details), 2.5 Å
SCOP Domain Sequences for d1oh7b4:
Sequence, based on SEQRES records: (download)
>d1oh7b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli} mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagipy havenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
>d1oh7b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli} mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl vnqgesvaicerkvvrivtp
Timeline for d1oh7b4:
View in 3D Domains from other chains: (mouse over for more information) d1oh7a1, d1oh7a2, d1oh7a3, d1oh7a4 |