Lineage for d1oh7b3 (1oh7 B:117-269)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 398035Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 398036Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 398037Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 398038Species Escherichia coli [TaxId:562] [53154] (6 PDB entries)
  8. 398046Domain d1oh7b3: 1oh7 B:117-269 [93001]
    Other proteins in same PDB: d1oh7a1, d1oh7a2, d1oh7a4, d1oh7b1, d1oh7b2, d1oh7b4
    complexed with adp, mo4

Details for d1oh7b3

PDB Entry: 1oh7 (more details), 2.5 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:g mismatch

SCOP Domain Sequences for d1oh7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh7b3 c.55.6.1 (B:117-269) DNA repair protein MutS, domain II {Escherichia coli}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOP Domain Coordinates for d1oh7b3:

Click to download the PDB-style file with coordinates for d1oh7b3.
(The format of our PDB-style files is described here.)

Timeline for d1oh7b3: