Lineage for d1oh7b1 (1oh7 B:270-566)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775145Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 775146Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 775147Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 775148Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 775149Species Escherichia coli [TaxId:562] [48338] (10 PDB entries)
    Uniprot P23909 2-800
  8. 775162Domain d1oh7b1: 1oh7 B:270-566 [92999]
    Other proteins in same PDB: d1oh7a2, d1oh7a3, d1oh7a4, d1oh7b2, d1oh7b3, d1oh7b4
    complexed with adp, mo4

Details for d1oh7b1

PDB Entry: 1oh7 (more details), 2.5 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:g mismatch
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1oh7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh7b1 a.113.1.1 (B:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOP Domain Coordinates for d1oh7b1:

Click to download the PDB-style file with coordinates for d1oh7b1.
(The format of our PDB-style files is described here.)

Timeline for d1oh7b1: