![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) ![]() |
![]() | Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
![]() | Protein DNA repair protein MutS, domain II [53152] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [53154] (10 PDB entries) Uniprot P23909 2-800 |
![]() | Domain d1oh7a3: 1oh7 A:117-269 [92997] Other proteins in same PDB: d1oh7a1, d1oh7a2, d1oh7a4, d1oh7b1, d1oh7b2, d1oh7b4 complexed with adp, mg |
PDB Entry: 1oh7 (more details), 2.5 Å
SCOPe Domain Sequences for d1oh7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh7a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]} gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca agcllqyakdtqrttlphirsitmereqdsiim
Timeline for d1oh7a3:
![]() Domains from other chains: (mouse over for more information) d1oh7b1, d1oh7b2, d1oh7b3, d1oh7b4 |