Lineage for d1oh7a3 (1oh7 A:117-269)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837560Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 837561Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 837562Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 837563Species Escherichia coli [TaxId:562] [53154] (10 PDB entries)
    Uniprot P23909 2-800
  8. 837575Domain d1oh7a3: 1oh7 A:117-269 [92997]
    Other proteins in same PDB: d1oh7a1, d1oh7a2, d1oh7a4, d1oh7b1, d1oh7b2, d1oh7b4

Details for d1oh7a3

PDB Entry: 1oh7 (more details), 2.5 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:g mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1oh7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh7a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOP Domain Coordinates for d1oh7a3:

Click to download the PDB-style file with coordinates for d1oh7a3.
(The format of our PDB-style files is described here.)

Timeline for d1oh7a3: