Lineage for d1oh6b1 (1oh6 B:270-566)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921718Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 921719Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 921720Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 921721Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 921722Species Escherichia coli [TaxId:562] [48338] (10 PDB entries)
    Uniprot P23909 2-800
  8. 921729Domain d1oh6b1: 1oh6 B:270-566 [92991]
    Other proteins in same PDB: d1oh6a2, d1oh6a3, d1oh6a4, d1oh6b2, d1oh6b3, d1oh6b4
    complexed with adp, mg

Details for d1oh6b1

PDB Entry: 1oh6 (more details), 2.4 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an a:a mismatch
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh6b1 a.113.1.1 (B:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOPe Domain Coordinates for d1oh6b1:

Click to download the PDB-style file with coordinates for d1oh6b1.
(The format of our PDB-style files is described here.)

Timeline for d1oh6b1: