| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) ![]() |
| Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein) |
| Protein DNA repair protein MutS, domain III [48336] (2 species) |
| Species Escherichia coli [TaxId:562] [48338] (8 PDB entries) Uniprot P23909 2-800 |
| Domain d1oh6b1: 1oh6 B:270-566 [92991] Other proteins in same PDB: d1oh6a2, d1oh6a3, d1oh6a4, d1oh6b2, d1oh6b3, d1oh6b4 complexed with adp, mg |
PDB Entry: 1oh6 (more details), 2.4 Å
SCOPe Domain Sequences for d1oh6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh6b1 a.113.1.1 (B:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d1oh6b1:
View in 3DDomains from other chains: (mouse over for more information) d1oh6a1, d1oh6a2, d1oh6a3, d1oh6a4 |