SCOP 1.75: Domain d1oh6a4: 1oh6 A:2-116

Lineage for d1oh6a4 (1oh6 A:2-116)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family)

5. Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)

6. Protein DNA repair protein MutS, domain I [55273] (2 species)

7. Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
   Uniprot P23909 2-800

8. Domain d1oh6a4: 1oh6 A:2-116 [92990]
   Other proteins in same PDB: d1oh6a1, d1oh6a2, d1oh6a3, d1oh6b1, d1oh6b2, d1oh6b3

Details for d1oh6a4

PDB Entry: 1oh6, 2.4 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an a:a mismatch

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1oh6a4:

Sequence; same for both SEQRES and ATOM records:

>d1oh6a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Timeline for d1oh6a4:

• d1oh6a4 first appeared in SCOP 1.67
  
• d1oh6a4 appears in SCOP 1.73
  
• d1oh6a4 appears in SCOPe 2.01
  
• d1oh6a4 appears in the current release, SCOPe 2.08