| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) ![]() |
| Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
| Protein DNA repair protein MutS, domain I [55273] (2 species) |
| Species Escherichia coli [TaxId:562] [55275] (10 PDB entries) Uniprot P23909 2-800 |
| Domain d1oh6a4: 1oh6 A:2-116 [92990] Other proteins in same PDB: d1oh6a1, d1oh6a2, d1oh6a3, d1oh6b1, d1oh6b2, d1oh6b3 |
PDB Entry: 1oh6 (more details), 2.4 Å
SCOP Domain Sequences for d1oh6a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh6a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
Timeline for d1oh6a4:
View in 3DDomains from other chains: (mouse over for more information) d1oh6b1, d1oh6b2, d1oh6b3, d1oh6b4 |