| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) ![]() |
| Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein) |
| Protein DNA repair protein MutS, domain II [53152] (2 species) |
| Species Escherichia coli [TaxId:562] [53154] (10 PDB entries) |
| Domain d1oh6a3: 1oh6 A:117-269 [92989] Other proteins in same PDB: d1oh6a1, d1oh6a2, d1oh6a4, d1oh6b1, d1oh6b2, d1oh6b4 |
PDB Entry: 1oh6 (more details), 2.4 Å
SCOP Domain Sequences for d1oh6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh6a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim
Timeline for d1oh6a3:
View in 3DDomains from other chains: (mouse over for more information) d1oh6b1, d1oh6b2, d1oh6b3, d1oh6b4 |