Lineage for d1oh6a3 (1oh6 A:117-269)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887747Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (2 families) (S)
  5. 2887748Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 2887749Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 2887750Species Escherichia coli [TaxId:562] [53154] (8 PDB entries)
    Uniprot P23909 2-800
  8. 2887754Domain d1oh6a3: 1oh6 A:117-269 [92989]
    Other proteins in same PDB: d1oh6a1, d1oh6a2, d1oh6a4, d1oh6b1, d1oh6b2, d1oh6b4
    complexed with adp, mg

Details for d1oh6a3

PDB Entry: 1oh6 (more details), 2.4 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an a:a mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh6a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOPe Domain Coordinates for d1oh6a3:

Click to download the PDB-style file with coordinates for d1oh6a3.
(The format of our PDB-style files is described here.)

Timeline for d1oh6a3: