Lineage for d1oh5b4 (1oh5 B:14-116)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865422Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865453Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 865454Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 865455Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 865456Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
    Uniprot P23909 2-800
  8. 865471Domain d1oh5b4: 1oh5 B:14-116 [92986]
    Other proteins in same PDB: d1oh5a1, d1oh5a2, d1oh5a3, d1oh5b1, d1oh5b2, d1oh5b3
    complexed with adp, mo4

Details for d1oh5b4

PDB Entry: 1oh5 (more details), 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a c:a mismatch
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1oh5b4:

Sequence, based on SEQRES records: (download)

>d1oh5b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgasagepipmagipy
havenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Sequence, based on observed residues (ATOM records): (download)

>d1oh5b4 d.75.2.1 (B:14-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
vnqgesvaicerkvvrivtp

SCOP Domain Coordinates for d1oh5b4:

Click to download the PDB-style file with coordinates for d1oh5b4.
(The format of our PDB-style files is described here.)

Timeline for d1oh5b4: