Class a: All alpha proteins [46456] (284 folds) |
Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) |
Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein) |
Protein DNA repair protein MutS, domain III [48336] (2 species) |
Species Escherichia coli [TaxId:562] [48338] (10 PDB entries) Uniprot P23909 2-800 |
Domain d1oh5a1: 1oh5 A:270-566 [92979] Other proteins in same PDB: d1oh5a2, d1oh5a3, d1oh5a4, d1oh5b2, d1oh5b3, d1oh5b4 complexed with adp, mg |
PDB Entry: 1oh5 (more details), 2.9 Å
SCOPe Domain Sequences for d1oh5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh5a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]} daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d1oh5a1:
View in 3D Domains from other chains: (mouse over for more information) d1oh5b1, d1oh5b2, d1oh5b3, d1oh5b4 |