SCOP 1.67: Domain d1ogvl_: 1ogv L:

Lineage for d1ogvl_ (1ogv L:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (38 PDB entries)

8. Domain d1ogvl_: 1ogv L: [92950]
   Other proteins in same PDB: d1ogvh1, d1ogvh2, d1ogvm_
   complexed with bcl, bph, cdl, cl, fe2, u10

Details for d1ogvl_

PDB Entry: 1ogv, 2.35 Å

PDB Description: lipidic cubic phase crystal structure of the photosynthetic reaction centre from rhodobacter sphaeroides

SCOP Domain Sequences for d1ogvl_:

Sequence; same for both SEQRES and ATOM records:

>d1ogvl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1ogvl_:

• d1ogvl_ is new in SCOP 1.67
  
• d1ogvl_ appears in SCOP 1.69
  
• d1ogvl_ appears in the current release, SCOPe 2.08