SCOPe 2.06: Domain d1ogvh1: 1ogv H:36-247

Lineage for d1ogvh1 (1ogv H:36-247)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries)
   Uniprot P11846

8. Domain d1ogvh1: 1ogv H:36-247 [92948]
   Other proteins in same PDB: d1ogvh2, d1ogvl_, d1ogvm_
   complexed with bcl, bph, cdl, cl, fe2, u10

Details for d1ogvh1

PDB Entry: 1ogv, 2.35 Å

PDB Description: lipidic cubic phase crystal structure of the photosynthetic reaction centre from rhodobacter sphaeroides

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1ogvh1:

Sequence; same for both SEQRES and ATOM records:

>d1ogvh1 b.41.1.1 (H:36-247) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapk

Timeline for d1ogvh1:

• d1ogvh1 first appeared in SCOP 1.67
  
• d1ogvh1 appears in SCOPe 2.05
  
• d1ogvh1 appears in SCOPe 2.07
  
• d1ogvh1 appears in the current release, SCOPe 2.08