SCOP 1.67: Domain d1ogud1: 1ogu D:178-309

Lineage for d1ogud1 (1ogu D:178-309)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (24 PDB entries)

8. Domain d1ogud1: 1ogu D:178-309 [92946]
   Other proteins in same PDB: d1ogua_, d1oguc_

Details for d1ogud1

PDB Entry: 1ogu, 2.6 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 2-arylamino-4-cyclohexylmethyl-5-nitroso-6-aminopyrimidine inhibitor

SCOP Domain Sequences for d1ogud1:

Sequence; same for both SEQRES and ATOM records:

>d1ogud1 a.74.1.1 (D:178-309) Cyclin A {Human (Homo sapiens)}
yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
vlkvltfdlaap

Timeline for d1ogud1:

• d1ogud1 is new in SCOP 1.67
  
• d1ogud1 appears in SCOP 1.69
  
• d1ogud1 appears in the current release, SCOPe 2.08