SCOP 1.71: Domain d1oguc_: 1ogu C:

Lineage for d1oguc_ (1ogu C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (80 PDB entries)

8. Domain d1oguc_: 1ogu C: [92945]
   Other proteins in same PDB: d1ogub1, d1ogub2, d1ogud1, d1ogud2
   complex with cyclin
   complexed with sgm, st8

Details for d1oguc_

PDB Entry: 1ogu, 2.6 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 2-arylamino-4-cyclohexylmethyl-5-nitroso-6-aminopyrimidine inhibitor

SCOP Domain Sequences for d1oguc_:

Sequence, based on SEQRES records:

>d1oguc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Sequence, based on observed residues (ATOM records):

>d1oguc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtfskvvppldedgrsll
sqmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d1oguc_:

• d1oguc_ first appeared in SCOP 1.67
  
• d1oguc_ appears in SCOP 1.69
  
• d1oguc_ appears in SCOP 1.73
  
• d1oguc_ appears in the current release, SCOPe 2.08, called d1oguc1