Lineage for d1ogta2 (1ogt A:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182896Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries)
    Uniprot P03989 25-300
  8. 2182898Domain d1ogta2: 1ogt A:1-181 [92940]
    Other proteins in same PDB: d1ogta1, d1ogtb1, d1ogtb2
    complexed with gol, mn

Details for d1ogta2

PDB Entry: 1ogt (more details), 1.47 Å

PDB Description: crystal structure of hla-b*2705 complexed with the vasoactive intestinal peptide type 1 receptor (vipr) peptide (residues 400-408)
PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d1ogta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogta2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d1ogta2:

Click to download the PDB-style file with coordinates for d1ogta2.
(The format of our PDB-style files is described here.)

Timeline for d1ogta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogta1