Lineage for d1ogta2 (1ogt A:1-181)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501142Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)
  7. 501220Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (6 PDB entries)
  8. 501222Domain d1ogta2: 1ogt A:1-181 [92940]
    Other proteins in same PDB: d1ogta1, d1ogtb_

Details for d1ogta2

PDB Entry: 1ogt (more details), 1.47 Å

PDB Description: crystal structure of hla-b*2705 complexed with the vasoactive intestinal peptide type 1 receptor (vipr) peptide (residues 400-408)

SCOP Domain Sequences for d1ogta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogta2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOP Domain Coordinates for d1ogta2:

Click to download the PDB-style file with coordinates for d1ogta2.
(The format of our PDB-style files is described here.)

Timeline for d1ogta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogta1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ogtb_