Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein) automatically mapped to Pfam PF03404 |
Protein Sulfite oxidase, C-terminal domain [49259] (2 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101528] (1 PDB entry) |
Domain d1ogpa1: 1ogp A:263-389 [92927] Other proteins in same PDB: d1ogpa2, d1ogpb2, d1ogpc2, d1ogpd2, d1ogpe2, d1ogpf2 complexed with cs, gol, mtq |
PDB Entry: 1ogp (more details), 2.6 Å
SCOPe Domain Sequences for d1ogpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogpa1 b.1.18.6 (A:263-389) Sulfite oxidase, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dfpvqsaicsvedvqmvkpgkvsikgyavsgggrgiervdisldggknwveasrtqepgk qyisehsssdkwawvlfeatidvsqtteviakavdsaanvqpenvesvwnlrgvlntswh rvllrlg
Timeline for d1ogpa1: