Lineage for d1ogja2 (1ogj A:142-303)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 391988Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 391989Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 391990Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 391997Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 392000Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [52350] (19 PDB entries)
  8. 392002Domain d1ogja2: 1ogj A:142-303 [92917]
    Other proteins in same PDB: d1ogja1
    complexed with fad, so4; mutant

Details for d1ogja2

PDB Entry: 1ogj (more details), 1.64 Å

PDB Description: ferredoxin:nadp+ reductase mutant with leu 263 replaced by pro (l263p)

SCOP Domain Sequences for d1ogja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogja2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
gprgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

SCOP Domain Coordinates for d1ogja2:

Click to download the PDB-style file with coordinates for d1ogja2.
(The format of our PDB-style files is described here.)

Timeline for d1ogja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ogja1