Class b: All beta proteins [48724] (180 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) |
Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
Protein Chitinase B, C-terminal domain [51061] (1 species) |
Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries) |
Domain d1ogga1: 1ogg A:447-499 [92908] Other proteins in same PDB: d1ogga2, d1ogga3, d1oggb2, d1oggb3 complexed with ami, gol, so4; mutant |
PDB Entry: 1ogg (more details), 1.97 Å
SCOPe Domain Sequences for d1ogga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ogga1 b.72.2.1 (A:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]} nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1ogga1: