SCOP 1.75: Domain d1ogbb1: 1ogb B:447-499

Lineage for d1ogbb1 (1ogb B:447-499)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (14 PDB entries)

8. Domain d1ogbb1: 1ogb B:447-499 [92885]
   Other proteins in same PDB: d1ogba2, d1ogba3, d1ogbb2, d1ogbb3
   complexed with gol, so4; mutant

Details for d1ogbb1

PDB Entry: 1ogb, 1.85 Å

PDB Description: chitinase b from serratia marcescens mutant d142n

PDB Compounds: (B:) chitinase b

SCOP Domain Sequences for d1ogbb1:

Sequence; same for both SEQRES and ATOM records:

>d1ogbb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

Timeline for d1ogbb1:

• d1ogbb1 first appeared in SCOP 1.67
  
• d1ogbb1 appears in SCOP 1.73
  
• d1ogbb1 appears in SCOPe 2.01
  
• d1ogbb1 appears in the current release, SCOPe 2.08