Lineage for d1ogba1 (1ogb A:447-499)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808661Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 808732Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 808733Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 808740Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 808741Species Serratia marcescens [TaxId:615] [51062] (14 PDB entries)
  8. 808748Domain d1ogba1: 1ogb A:447-499 [92882]
    Other proteins in same PDB: d1ogba2, d1ogba3, d1ogbb2, d1ogbb3

Details for d1ogba1

PDB Entry: 1ogb (more details), 1.85 Å

PDB Description: chitinase b from serratia marcescens mutant d142n
PDB Compounds: (A:) chitinase b

SCOP Domain Sequences for d1ogba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogba1 b.72.2.1 (A:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

SCOP Domain Coordinates for d1ogba1:

Click to download the PDB-style file with coordinates for d1ogba1.
(The format of our PDB-style files is described here.)

Timeline for d1ogba1: