SCOP 1.71: Domain d1og9c2: 1og9 C:254-406

Lineage for d1og9c2 (1og9 C:254-406)

Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (2 families)
Family c.95.1.1: Thiolase-related [53902] (8 proteins)
Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
Species Escherichia coli [TaxId:562] [53908] (11 PDB entries)
Domain d1og9c2: 1og9 C:254-406 [92879]

Details for d1og9c2

PDB Entry: 1og9 (more details), 2.4 Å

PDB Description: e. coli beta-ketoacyl [acyl carrier protein] synthase i in complex with octanoic acid, 120k

SCOP Domain Sequences for d1og9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1og9c2 c.95.1.1 (C:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOP Domain Coordinates for d1og9c2:

Click to download the PDB-style file with coordinates for d1og9c2.
(The format of our PDB-style files is described here.)

Timeline for d1og9c2: