![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (4 families) ![]() |
![]() | Family d.166.1.3: Ecto-ART [82814] (1 protein) the two disulfide bridges and N-terminal alpha helices are characteristic for all ecto-ARTs |
![]() | Protein Eukaryotic mono-ADP-ribosyltransferase ART2.2 [82815] (1 species) NAD glycohydrolase and auto-ADP-ribosylation activity |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [82816] (6 PDB entries) |
![]() | Domain d1og4a_: 1og4 A: [92864] |
PDB Entry: 1og4 (more details), 2.6 Å
SCOP Domain Sequences for d1og4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1og4a_ d.166.1.3 (A:) Eukaryotic mono-ADP-ribosyltransferase ART2.2 {Rat (Rattus norvegicus)} plmldtapnafddqyegcvnkmeekaplllqedfnmnaklkvaweeakkrwnnikpsrsy pkgfndfhgtalvaytgsiavdfnravrefkenpgqfhykafhyyltralqllsngdchs vyrgtktrfhytgagsvrfgqftssslskkvaqsqeffsdhgtlfiiktclgvyikefsf rpdqeavlipgyevyqkvrtqgyneifldspkrkksnynclys
Timeline for d1og4a_: