Lineage for d1og4a_ (1og4 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421044Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 421045Superfamily d.166.1: ADP-ribosylation [56399] (3 families) (S)
  5. 421165Family d.166.1.3: Ecto-ART [82814] (1 protein)
    the two disulfide bridges and N-terminal alpha helices are characteristic for all ecto-ARTs
  6. 421166Protein Eukaryotic mono-ADP-ribosyltransferase ART2.2 [82815] (1 species)
    NAD glycohydrolase and auto-ADP-ribosylation activity
  7. 421167Species Rat (Rattus norvegicus) [TaxId:10116] [82816] (6 PDB entries)
  8. 421174Domain d1og4a_: 1og4 A: [92864]
    complexed with nai; mutant

Details for d1og4a_

PDB Entry: 1og4 (more details), 2.6 Å

PDB Description: crystal structure of the eucaryotic mono-adp-ribosyltransferase art2.2 mutant e189a in complex with nadh

SCOP Domain Sequences for d1og4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1og4a_ d.166.1.3 (A:) Eukaryotic mono-ADP-ribosyltransferase ART2.2 {Rat (Rattus norvegicus)}
plmldtapnafddqyegcvnkmeekaplllqedfnmnaklkvaweeakkrwnnikpsrsy
pkgfndfhgtalvaytgsiavdfnravrefkenpgqfhykafhyyltralqllsngdchs
vyrgtktrfhytgagsvrfgqftssslskkvaqsqeffsdhgtlfiiktclgvyikefsf
rpdqeavlipgyevyqkvrtqgyneifldspkrkksnynclys

SCOP Domain Coordinates for d1og4a_:

Click to download the PDB-style file with coordinates for d1og4a_.
(The format of our PDB-style files is described here.)

Timeline for d1og4a_: