SCOPe 2.07: Domain d1og3a_: 1og3 A:

Lineage for d1og3a_ (1og3 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.3: Ecto-ART [82814] (1 protein)
   the two disulfide bridges and N-terminal alpha helices are characteristic for all ecto-ARTs
   automatically mapped to Pfam PF01129

6. Protein Eukaryotic mono-ADP-ribosyltransferase ART2.2 [82815] (1 species)
   NAD glycohydrolase and auto-ADP-ribosylation activity

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [82816] (6 PDB entries)

8. Domain d1og3a_: 1og3 A: [92863]
   complexed with nad; mutant

Details for d1og3a_

PDB Entry: 1og3, 2.6 Å

PDB Description: crystal structure of the eukaryotic mono-adp-ribosyltransferase art2.2 mutant e189i in complex with nad

PDB Compounds: (A:) T-cell ecto-ADP-ribosyltransferase 2

SCOPe Domain Sequences for d1og3a_:

Sequence; same for both SEQRES and ATOM records:

>d1og3a_ d.166.1.3 (A:) Eukaryotic mono-ADP-ribosyltransferase ART2.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plmldtapnafddqyegcvnkmeekaplllqedfnmnaklkvaweeakkrwnnikpsrsy
pkgfndfhgtalvaytgsiavdfnravrefkenpgqfhykafhyyltralqllsngdchs
vyrgtktrfhytgagsvrfgqftssslskkvaqsqeffsdhgtlfiiktclgvyikefsf
rpdqeivlipgyevyqkvrtqgyneifldspkrkksnynclys

Timeline for d1og3a_:

• d1og3a_ first appeared in SCOP 1.67
  
• d1og3a_ appears in SCOPe 2.06
  
• d1og3a_ appears in the current release, SCOPe 2.08