Lineage for d1ofre_ (1ofr E:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 385592Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 385893Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 385894Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (2 species)
  7. 385895Species Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId:4932] [82272] (11 PDB entries)
  8. 385942Domain d1ofre_: 1ofr E: [92846]

Details for d1ofre_

PDB Entry: 1ofr (more details), 2.7 Å

PDB Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phenylalanine and manganese

SCOP Domain Sequences for d1ofre_:

Sequence, based on SEQRES records: (download)

>d1ofre_ c.1.10.4 (E:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme}
eedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsih
dleaaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglq
sarqlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvg
fkngtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnyda
ksvaeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesni
negnqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk

Sequence, based on observed residues (ATOM records): (download)

>d1ofre_ c.1.10.4 (E:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme}
eedvrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsih
dleaaqeyalrlkklsdelkgdlsiimraylekpwkglindpdvnntfninkglqsarql
fvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkngt
dgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksvae
akaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesninegnq
gipkygvsitdacigwettedvlrklaaavrqrrevnkk

SCOP Domain Coordinates for d1ofre_:

Click to download the PDB-style file with coordinates for d1ofre_.
(The format of our PDB-style files is described here.)

Timeline for d1ofre_: